PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00869.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 318aa    MW: 36151.6 Da    PI: 6.2991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00869.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ +   G  +W+t ++  g+ R++k+c++rw +yl
  Rsa1.0_00869.1_g00004.1 14 KGPWTAEEDKKLINFILTNGHCCWRTLPKLSGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding51.22.8e-1671111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_00869.1_g00004.1  71 SECEEQMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                              5669**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.946961IPR017930Myb domain
SuperFamilySSF466891.09E-2611108IPR009057Homeodomain-like
SMARTSM007173.9E-111363IPR001005SANT/Myb domain
PfamPF002491.0E-121461IPR001005SANT/Myb domain
CDDcd001676.04E-81661No hitNo description
PROSITE profilePS5129426.19562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2464116IPR009057Homeodomain-like
SMARTSM007173.6E-1466114IPR001005SANT/Myb domain
PfamPF002495.5E-1471111IPR001005SANT/Myb domain
CDDcd001679.71E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGHCCWRTL PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGLL SECEEQMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPMTHKPLP EQDGSQQAQG SRSLEPHDDK NTKQEDKQTK EKQEHHQLGI HLDKSNTTIS  180
TDDGFCIDEV PLLDPHEILL DMSFAHHNTS AENAHINISN STSPSSSSSS TASGISSVPG  240
EEFSKFLEEM EIIDLKWLSS DHSSGDNIIY KDAKLDNNVD TMNLWDINYL SSLELFMNDH  300
DDDFVGSRMF KNGLDQYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747510.0KF974751.1 Brassica napus MYB transcription factor 43-1 (MYB43-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607265.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0N6YZT20.0A0A0N6YZT2_BRANA; MYB transcription factor 43-1
STRINGAT5G16600.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-139myb domain protein 43